PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013644.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 638aa    MW: 69269.1 Da    PI: 6.0329
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013644.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS392.54.7e-1202306242374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   +lLl+cAeavs+++  +a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y++lp s+ + + +++ ++a+++f+ +sP++kfsh+taN
  Pbr013644.1 230 LTLLLQCAEAVSADNYDEATKMLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYASLPHSSVPVTYTQKMVSAFQVFNGISPFVKFSHFTAN 327
                  579*****************************************************************9999************************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  qaI ea+e+e+rvHi+D+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s  +le+tg+rL++fA++lg+pfef + va+++ +l+le+L+++
  Pbr013644.1 328 QAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMVALEATGKRLSDFADKLGLPFEFFP-VAEKVGNLDLERLNIS 420
                  **************************************************....***************************.7*************** PP

         GRAS 198 pgEalaVnlvlqlhrll................................desvsles.erdevLklvk.slsPkvvvvveqeadhnsesFlerfleal 261
                  ++Ea+aV++    h+l+                                      +  + ++ L +   +l Pkvv+vveq+++h ++sFl rf+ea+
  Pbr013644.1 421 KREAVAVHWLQ--HSLYdvtgsdsntlwllqaeyqqergcggalaaafaL---RCHGfRFQHALAFAEvTLAPKVVTVVEQDLSH-AGSFLGRFVEAI 512
                  ********998..5555557************************774431...333345677888776489**************.899********* PP

         GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                  +yysalfdsl a++++eseer++vE++ll+rei+nv+a  g +r  + + +++Wre+++++GF+ ++l  +aa+qa lll +++sdgy++ e++g+l 
  Pbr013644.1 513 HYYSALFDSLGASYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGEVK-FHNWREKFQQSGFRGISLAGNAATQATLLLGMFPSDGYTLVEDNGTLK 609
                  *******************************************888776.************************************************ PP

         GRAS 360 lgWkdrpLvsvSaWr 374
                  lgWkd  L+++SaWr
  Pbr013644.1 610 LGWKDLCLLTASAWR 624
                  **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.707203604IPR005202Transcription factor GRAS
PfamPF035141.6E-117230624IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MEDGSSAATA WIDGIIKDLI HSSTNVSIPQ LIHNVREIIF PCNPSLAALL EYRLRSISEP  60
PPPPLPLPVP SFNPTPIPDM RSRQQGGPGP GALKLNLDSG ALHDVAIFNT STADNNDLYL  120
QSWSGGGGGV GLSLPQPNPT HVPMTCNQTN PHHQSPSFNQ AIHQTQDKQL ENSSSSSPAA  180
ESTTPTAAPA PTTATATAPP QPTTSAVSLL REKKEEMRQQ KRDEEGLHLL TLLLQCAEAV  240
SADNYDEATK MLLEISELST PFGTSAQRVA AYFSEAMSAR LVSSCLGIYA SLPHSSVPVT  300
YTQKMVSAFQ VFNGISPFVK FSHFTANQAI QEAFEREDRV HIVDLDIMQG LQWPGLFHIL  360
ASRPGGPPYV RLTGLGTSMV ALEATGKRLS DFADKLGLPF EFFPVAEKVG NLDLERLNIS  420
KREAVAVHWL QHSLYDVTGS DSNTLWLLQA EYQQERGCGG ALAAAFALRC HGFRFQHALA  480
FAEVTLAPKV VTVVEQDLSH AGSFLGRFVE AIHYYSALFD SLGASYGEES EERHVVEQQL  540
LSREIRNVLA VGGPSRSGEV KFHNWREKFQ QSGFRGISLA GNAATQATLL LGMFPSDGYT  600
LVEDNGTLKL GWKDLCLLTA SAWRPPYHAA PNPNLHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-462296244375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370922.10.0PREDICTED: protein SCARECROW 1-like
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLM5WLC90.0M5WLC9_PRUPE; Uncharacterized protein
STRINGPOPTR_0016s15060.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein